Cartoon tattoo by Ariesinkedme | TattMe

Discover For Artists For Clients About Contact Start Booking

Discover tattoo artists and book your next tattoo — all in one place.

Product

Discover Artists
For Artists
For Clients
Start Booking

Company

About Us
Contact

Legal

Terms of Service
Privacy Policy

Browse by Style

Black & Grey Artists
Cover-Ups Artists
Line-work Artists
Cartoon Artists
Floral Artists
Fine Line Artists
Color Artists
Anime Artists

Artists by City

Baltimore, Maryland
Houston, Texas
Atlanta, Georgia
Jacksonville, Florida
Decatur, Georgia
Montgomery, Alabama
Indianapolis, Indiana
Waldorf, Maryland

Shops by City

Baltimore, Maryland
Jacksonville, Florida
Atlanta, Georgia
Temple Hills, Maryland
Cincinnati, Ohio
Memphis, Tennessee
Decatur, Georgia
Dallas, Texas

© 2026 TattMe Inc. All rights reserved.

Cartoon tattoo by Ariesinkedme | TattMe

← Back to Ariesinkedme

Fine Line + Black-work leaves tattoo on Chest by Ariesinkedme on TattMe — Chest
Fine Line, Black-work, Floral, Minimalist, Illustrative
leavesbrancheswreathfoliagebotanical designnature motifornament

Floral + Color butterflies tattoo on Calf by Ariesinkedme on TattMe — Calf
Floral, Color, Fine Line, Illustrative
butterfliesrosesflowersyeardatenatureflorainsectssymbolic

Floral + Color roses tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Floral, Color, Line-work, Illustrative
rosesflowersbutterfliesfloralnaturedelicate

Color + Illustrative baby foot tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Color, Illustrative, Floral, Lettering
baby footflowermirrormoonstarsnamedateremembrance

Floral + Color flowers tattoo on Shoulder Blade by Ariesinkedme on TattMe — Shoulder Blade
Floral, Color, Illustrative, Lettering
flowersbutterfliesdragonflystarstextnaturegraceamazing

Lettering + Fine Line lettering tattoo by Ariesinkedme on TattMe — Lettering, Fine Line, Black & Grey, Color, Illustrative, Dot-work, Minimalist
letteringtextroman numeralsnumberslotusunalomebutterflygoldfisheyesymbols

Illustrative + Black & Grey sea turtle tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Illustrative, Black & Grey
sea turtlemarine lifeoceananimalnature

Lettering + Fine Line text tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Lettering, Fine Line, Minimalist, Black-work
textwordsphraseletteringquotemotivation

Fine Line + Line-work capricorn tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Line-work, Minimalist, Script, Floral
capricornsea goatzodiacconstellationflowersstarsscriptanimalmythical creatureline art

Lettering + Fine Line text tattoo on Neck (Side) by Ariesinkedme on TattMe — Neck (Side)
Lettering, Fine Line, Color, Black-work, Minimalist
textwordpotentialinfinitysymbolmessage

Lettering + Script hutch tattoo on Hand by Ariesinkedme on TattMe — Hand
Lettering, Script, Fine Line
hutchnamewordscriptletteringcalligraphytypographyhandtexttattoo

Black-work + Script godspeed tattoo on Shoulder Blade by Ariesinkedme on TattMe — Shoulder Blade
Black-work, Script, Lettering, Abstract
godspeedscriptspiritsabstract shapesblack inkspiralenergymovemententities

Black-work + Illustrative skull tattoo on Chest by Ariesinkedme on TattMe — Chest
Black-work, Illustrative
skullheaddressfeathersgeometric patternsnative american imageryblack ink

Fine Line + Black-work butterfly tattoo on Upper Back by Ariesinkedme on TattMe — Upper Back
Fine Line, Black-work, Dot-work, Symbolic
butterflycrescent moonunalomewingssymbolspiritual designblack inknature motif

Black-work + Minimalist om symbol tattoo on Neck (Side) by Ariesinkedme on TattMe — Neck (Side)
Black-work, Minimalist, Symbolic, Fine Line
om symbolhinduismspiritualsymbolblack inkminimalistdevotion

Black-work + Pop Culture skeleton tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black-work, Pop Culture, Cartoon
skeletoncoffinflowersspiderwebjack skellingtoncartoonmovie charactergothichalloween

New School + Color eyeball tattoo on Forearm by Ariesinkedme on TattMe — Forearm
New School, Color, Illustrative
eyeballwingsbarbed wirenailsdrippingslimemonsterhorrorfantasycreature

Fine Line + Black-work tiger tattoo on Shoulder by Ariesinkedme on TattMe — Shoulder
Fine Line, Black-work, Illustrative, Animals
tigerstripesfelineanimalwildlifehead

Fine Line + Geometric symbol tattoo on Neck (Back) by Ariesinkedme on TattMe — Neck (Back)
Fine Line, Geometric, Line-work
symbolgeometriccirclestarpatternoutlinedesignsimple

Anime + Illustrative characters tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Anime, Illustrative, Color, Black-work
charactersanimemangawarriorgirlsmileduoportraitsword

Fine Line + Minimalist character tattoo on Neck (Side) by Ariesinkedme on TattMe — Neck (Side)
Fine Line, Minimalist, Black-work, Cartoon, Pop Culture
characterbughollow knightvideo gameoutlinecutecreaturecartoon

Line-work + Color book tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Line-work, Color, Geometric, Illustrative, Lettering
bookeyebannertextsymbolcircleslinesabstractcolor

Fine Line + Line-work phoenix tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Fine Line, Line-work, Black-work
phoenixbirdmooncrescentflorallilymythical creature

Black & Grey + Japanese cat tattoo on Calf by Ariesinkedme on TattMe — Calf
Black & Grey, Japanese, Cartoon, Illustrative
catmaneki-nekobowlbonsaiflowerssymbolsfelinejapanese motifcuteanimal

Color + Illustrative dinosaur tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Color, Illustrative
dinosaurrexcreaturemonsterteethclawsscalesanimal

Anime + Line-work anime tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Anime, Line-work, Black-work, Pop Culture, Minimalist
animecharacterninjafigureyouthmangasymbolline artblackworkpop culture

Pop Culture + Cartoon kirby tattoo on Shin by Ariesinkedme on TattMe — Shin
Pop Culture, Cartoon, Color
kirbyheartpixelscharactercreaturevideo gamedesignsymbolartworkgaming

Black-work + Minimalist ghost tattoo on Ankle by Ariesinkedme on TattMe — Ankle
Black-work, Minimalist, Illustrative, Cartoon, Fine Line
ghostbatspookyhalloweencreaturespiritanimalcartoon

Illustrative + Color flamel symbol tattoo on Shin by Ariesinkedme on TattMe — Shin
Illustrative, Color, Anime, Pop Culture
flamel symbolfullmetal alchemistsymbolstarcirclered inkanimepop culturemangafantasy

Black & Grey + Black-work zeppelin tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black & Grey, Black-work, Illustrative
zeppelinairshipexplosionclouddisastermusicalbum coverframediconic

Minimalist + Geometric symbol tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Minimalist, Geometric, Line-work, Fine Line, Color
symbolcrossgeometriclinesminimalistredblack

Fine Line + Illustrative butterfly tattoo on Neck (Back) by Ariesinkedme on TattMe — Neck (Back)
Fine Line, Illustrative, Black-work
butterflystarsswirlsdelicatewhimsicalfantasynatureornamentalminimal

Black-work + Illustrative eagle tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Black-work, Illustrative, Lettering
eaglebirdwingsribbontextletteringmemorialpatriotismabstractpattern

Fine Line + Floral leaves tattoo on Sternum by Ariesinkedme on TattMe — Sternum
Fine Line, Floral, Minimalist, Black-work, Line-work
leavesbranchesfoliagebotanicalnatureplants

Fine Line + Dot-work cityscape tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Dot-work, Line-work, Geometric
cityscapearchitectureabstractlinesdotsgeometricblueprintoutline

Line-work + Illustrative butterfly tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Line-work, Illustrative
butterflywingsinsectnaturelinesdelicateflowingabstract

Black-work + Illustrative jester tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black-work, Illustrative, Fine Line, Patchwork
jesterfacesmasksheartexpressionslighterflamescharacter

Cartoon + Color winnie the pooh tattoo on Calf by Ariesinkedme on TattMe — Calf
Cartoon, Color, Lettering, Script, Pop Culture
winnie the poohcartoon characterhoney potbeequoteletteringdisney charactertextanimalscript

Lettering + Script rose tattoo on Chest by Ariesinkedme on TattMe — Chest
Lettering, Script, Floral, Color, Line-work
roseflowertextscriptquotefaith

Fine Line + Lettering lettering tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Lettering, Script, Minimalist, Black-work
letteringtextquotebutterfliesnumbersscriptdelicateinspirational

Fine Line + Floral lily tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Floral, Black & Grey, Line-work
lilyflowerfloralplantbloomnaturebotanicalblossom

tongue tattoo by Ariesinkedme on TattMe — tonguepiercingsmouthteethnecklacebutterflyjewelryshirtstripes

face tattoo by Ariesinkedme on TattMe — facenoselipspiercingjewelryskinpersonmouthchin

Lettering + Script name tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Script, Black-work
namescriptletteringtextwordtypographyarmtattoo

Black & Grey + Illustrative woman tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black & Grey, Illustrative
womanfacehelmetwingswarriorportraitvalkyriefantasy

Anime + Pop Culture anime characters tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Anime, Pop Culture, Black-work, Illustrative
anime characterscartoonpopular culturefan artillustrationblack inkfigures

Minimalist + Black-work semicolon tattoo on Face by Ariesinkedme on TattMe — Face
Minimalist, Black-work, Fine Line
semicolonsymboldotsminimalistface

Lettering + Script lettering tattoo on Face by Ariesinkedme on TattMe — Face
Lettering, Script, Floral
letteringscriptnametextflowersbotanicaloutlinedesign

Lettering + Script name tattoo on Neck (Side) by Ariesinkedme on TattMe — Neck (Side)
Lettering, Script, Fine Line, Black-work, Minimalist
namescriptletteringtextcursivesimplicityblack inkpersonal

Floral + Color flower tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Floral, Color, Tribal
flowerplumeriablossomtribalpatternswirlsleavestropicalnaturecolor

Cartoon + Pop Culture minnie mouse tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Cartoon, Pop Culture, Lettering, Fine Line, Color, Black-work
minnie mousecartoon charactersbowsnamestextnumbersdisneypersonalizationdate

Fine Line + Floral flowers tattoo on Calf by Ariesinkedme on TattMe — Calf
Fine Line, Floral, Line-work, Minimalist
flowersblossomsleavesbouquetplantsfoliageoutlinenature

Fine Line + Black-work manta ray tattoo on Calf by Ariesinkedme on TattMe — Calf
Fine Line, Black-work, Dot-work, Minimalist, Line-work
manta raysea creatureocean lifeanimaldotslinesmarine life

Fine Line + Minimalist cartoon tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Minimalist, Line-work, Cartoon, Black-work
cartooncharacterline artminimalistoutlineblack inksimple

Black & Grey + Pop Culture knife tattoo on Calf by Ariesinkedme on TattMe — Calf
Black & Grey, Pop Culture, Lettering, Line-work, Sketchy
knifemichael myerslighthouseghostface maskletteringbuttockshorrormovie characterpop culturetext

Illustrative + Black-work ghosts tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Illustrative, Black-work, Color, Line-work, Cartoon, Patchwork
ghostsballoonmothskeletonbicyclebannerpaper bagsrainbowcharacterspatchwork

Cartoon + Abstract smiley face tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Cartoon, Abstract, Line-work
smiley facemeltingcartoonexpressiondripsymbolhappyiconpop cultureabstract

Floral + Color tulips tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Floral, Color, Script, Fine Line
tulipsflowersnamesscriptpurpleredstemsleavesbotanical

Lettering + Script word tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Script, Black & Grey, Fine Line
wordscripttextcursivephraseinspirationtypographymessage

Black-work + Geometric symbol tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black-work, Geometric, Minimalist
symbolabstractgeometric shapesdesignblack inklines

Color + Cartoon pumpkin tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Color, Cartoon, Patchwork
pumpkinbugcreaturecartooninsectswhimsicalcolorfulsmallpatchwork

New School + Cartoon steak tattoo on Forearm by Ariesinkedme on TattMe — Forearm
New School, Cartoon, Color, Black-work, Tribal
steakmeatt-bonefoodcartoontribalblackworknumber

Black-work + Abstract eye tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Black-work, Abstract, Illustrative, Tribal
eyeabstractblackworkstylizedlinestribalmysticdesign

Black & Grey + Color elephants tattoo on Shoulder Blade by Ariesinkedme on TattMe — Shoulder Blade
Black & Grey, Color, Lettering, Illustrative, Animals, Floral
elephantsflowerstextquoteanimalsfamilynaturelovememorybond

Color + Illustrative symbol tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Color, Illustrative, Fine Line, Pop Culture
symbollogodiamondlettersgeometricanimemanga

Watercolor + Color heart tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Watercolor, Color, Line-work, Lettering, Minimalist
heartpuzzle piecedatecolorswatercolorforearmwristautismsymbolmemorial

Traditional + Color pittsburgh pirates tattoo on Upper Back by Ariesinkedme on TattMe — Upper Back
Traditional, Color, American Traditional
pittsburgh piratesbaseballlogoletter pitalian flagflagpatriotismsportssymbolheritage

Black & Grey + Illustrative rooster tattoo on Calf by Ariesinkedme on TattMe — Calf
Black & Grey, Illustrative, Line-work
roosterbirdfeathersleavesanimalwildlifenaturehead

Black-work + Illustrative moth tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Black-work, Illustrative, Dot-work
mothinsecteyemoonsstarscelestial elementsmystical symbol

Black-work + Illustrative woman tattoo on Ribs by Ariesinkedme on TattMe — Ribs
Black-work, Illustrative
womanfacedreadlocksknifeskullletteringcreateportraitsymbolicdark

Anime + Pop Culture gastly tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Anime, Pop Culture, Cartoon, Color
gastlyhaunterpokemoncharactersanimecartoonghostpop culturecreaturepurple

Fine Line + Minimalist girl tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Minimalist, Line-work, Black-work
girlbookflowersdaisiesheartoutlinereadingminimalism

Black-work + Line-work adinkra symbol tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black-work, Line-work, Black & Grey
adinkra symbolsankofaheartcrownletterinitialsymboldesignshapes

Fine Line + Minimalist snake tattoo on Sternum by Ariesinkedme on TattMe — Sternum
Fine Line, Minimalist
snakepisceszodiacsymbolserpentminimalsunburstdelicatelines

Lettering + Script heart tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Lettering, Script, Color
heartnamestextheartbeatloveinscription

Fine Line + Dot-work snitch tattoo on Ribs by Ariesinkedme on TattMe — Ribs
Fine Line, Dot-work, Pop Culture
snitchwingsspheredotsharry potterfantasymagical

Fine Line + Illustrative medusa tattoo on Full Leg Sleeve by Ariesinkedme on TattMe — Full Leg Sleeve
Fine Line, Illustrative, Floral, Line-work, Color
medusasnakesgoddessflowersdragonflylotusbookbutterfliesnaturemythology

Fine Line + Minimalist cat tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Minimalist, Line-work, Lettering, Animals
catanimalfelineoutlineminimalismladybugsscriptdesignpetcreature

Floral + Color flowers tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Floral, Color
flowerslilyrosebutterfliesbouquetnatureflorablossomspetalswings

Lettering + Black & Grey crosses tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Lettering, Black & Grey, Religious
crossesfaithfearsunburstcloudsquotetextreligious symbolsinspirational message

Lettering + Script rose tattoo on Hand by Ariesinkedme on TattMe — Hand
Lettering, Script, Floral, Black & Grey
roseflowerscriptletteringnamehearthandtattoo

face tattoo on Face by Ariesinkedme on TattMe — Face
facedreadlockspiercingshead coveringskin

Floral + Lettering flowers tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Floral, Lettering, Script, Line-work
flowersleavesheartscriptnamesquotetribute

Lettering + Illustrative crown tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Lettering, Illustrative, Floral, Black & Grey
crownletterscriptinitiallionesscubsflowersleavesfamilysymbol

Fine Line + Illustrative bow tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Illustrative, Color
bowribbonstarssparklespurplefemininedelicateillustrativecuteornament

Floral + Fine Line flowers tattoo on Shoulder Blade by Ariesinkedme on TattMe — Shoulder Blade
Floral, Fine Line, Line-work, Minimalist
flowersleavesfloralbotanicalnatureoutlinedelicate

Lettering + Script hebrew tattoo on Shoulder Blade by Ariesinkedme on TattMe — Shoulder Blade
Lettering, Script, Religious, Symbolic, Black-work
hebrewtextscriptletterssymbolname

Lettering + Script godspeed tattoo on Shoulder Blade by Ariesinkedme on TattMe — Shoulder Blade
Lettering, Script, Fine Line, Black-work
godspeedwordscriptcalligraphytext

Cartoon + Line-work cartoon tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Cartoon, Line-work, Pop Culture, Black-work
cartooncharactersboondocksafroglassesportraitsboysmanfamilyline art

Black-work + Illustrative tree tattoo on Hand by Ariesinkedme on TattMe — Hand
Black-work, Illustrative, Line-work
treebranchesrootsnaturefoliage

Black-work + Floral rose tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Black-work, Floral
roseflowerleavesnaturefloral

Fine Line + Minimalist tree tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Minimalist, Lettering, Dot-work, Abstract, Color
treebranchesletteringphrasesymboldotslinesabstract designminimal

Black & Grey + Floral mema tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black & Grey, Floral, Lettering, Script
memaroseflowerdatesscriptmemorialtribute

Lettering + Script name tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Script, Color, Floral
namerosescriptflowertypographyforearmtextred

Black & Grey + Illustrative angel tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black & Grey, Illustrative, Religious, Floral
angelwingsstarscrossesfigurereligiousrosefloralspirituality

Mandala + Floral flower tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Mandala, Floral, Line-work, Dot-work, Black-work, Geometric
flowermandalaornamentalline artdotsdropletspatternfloral

Lettering + Color rare tattoo on Chest by Ariesinkedme on TattMe — Chest
Lettering, Color, Dot-work
rarewordletteringcloudsstarreddark inktexture

Floral + Line-work sunflower tattoo on Ribs by Ariesinkedme on TattMe — Ribs
Floral, Line-work, Fine Line
sunflowerflowersbutterfliesfoliagesymbolletternaturefloralplants

Fine Line + Cartoon bear tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Cartoon, Minimalist, Line-work
bearcookiecartoonanimalcuteoutline

hand tattoo on Hand by Ariesinkedme on TattMe — Hand
handfingerpiercingsspikesjewelryskinbody modification

Pop Culture + Color mushroom tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Pop Culture, Color, New School
mushroomquestion blocksuper marionintendovideo gamepop culturecartoongaming

nose tattoo on Face by Ariesinkedme on TattMe — Face
nosepiercingseptumjewelryfacemetal

piercing tattoo on Face by Ariesinkedme on TattMe — Face
piercingeyebrowfacemetaljewelryskinbody modification

ear tattoo on Face by Ariesinkedme on TattMe — Face
earpiercingstudjewelryhairskin

ear tattoo by Ariesinkedme on TattMe — earpiercingsjewelryhairskin

ear tattoo on Face by Ariesinkedme on TattMe — Face
earpiercingsjewelryearringsindustrial barskinhairhandnecklacemarkings

ear tattoo by Ariesinkedme on TattMe — earpiercingshairbraidsheadbandskinhand

ear tattoo by Ariesinkedme on TattMe — earpiercingsindustrial piercingearlobe piercingjewelryhandnailsperson

belly button tattoo on Stomach by Ariesinkedme on TattMe — Stomach
belly buttonpiercingnaveljewelrybody artstomachskinjeans

Minimalist + Cartoon ghost tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Minimalist, Cartoon, Line-work, Fine Line
ghostheartscharactercartoonspiritillustrationsmilelines

Lettering + Dot-work letters tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Dot-work
letterstextwordfontdigitalpixelated

face tattoo on Face by Ariesinkedme on TattMe — Face
facelipsnosephiltrumpiercingjewelry

Fine Line + Illustrative brain tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Fine Line, Illustrative, Minimalist, Black-work
brainflowersheartbalanceline-workanatomybotanicalsymbolicminimalistdecorative

Fine Line + Floral sword tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Fine Line, Floral, Color, Illustrative
swordkatanacherry blossomsflowersbladenature

Lettering + Fine Line numbers tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Lettering, Fine Line, Black & Grey
numbersletteringinfinity symbolheartoutlinesymbolism

Lettering + Minimalist numbers tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Lettering, Minimalist, Fine Line, Black-work
numbersdigitsnumeralstextsymboloutline

Fine Line + Minimalist hand tattoo on Ribs by Ariesinkedme on TattMe — Ribs
Fine Line, Minimalist, Line-work, Symbolic
handfingersheartgesturesymbolloveminimalline art

Line-work + Geometric compass tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Line-work, Geometric, Fine Line
compassarrownavigationgeometricdirectiontravel

Lettering + Script mi amor tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Lettering, Script, Fine Line, Black-work
mi amorletteringscriptwordstextmessagefontinscription

Lettering + Script lettering tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Lettering, Script, Black-work, Fine Line
letteringscripttextphrasewordstypefontcalligraphy

Black & Grey + Illustrative money bags tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black & Grey, Illustrative
money bagsdollar signscurrencywealthbagssymbols

Lettering + Fine Line lettering tattoo on Hand by Ariesinkedme on TattMe — Hand
Lettering, Fine Line, Geometric, Black-work, Minimalist
letteringflowerdevil tailgeometricpatterntextwordssymbolismdelicate

Color + Illustrative angel tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Color, Illustrative, Fine Line, Lettering
angelhalowingsladybugsheartsscriptnameinsectssymbolicfigures

Black-work + Dot-work spider tattoo on Shoulder Blade by Ariesinkedme on TattMe — Shoulder Blade
Black-work, Dot-work, Minimalist
spiderblack widowarachnidinsectanimalminimalistcreepydark

Symbolic + Line-work ankh tattoo on Hand by Ariesinkedme on TattMe — Hand
Symbolic, Line-work, Black-work
ankheye of horusegyptian symbolssymbolshandsspiritualitycultureancient egypticonography

Anime + Cartoon eyes tattoo on Lower Back by Ariesinkedme on TattMe — Lower Back
Anime, Cartoon, Color, Line-work
eyesanimestarslashescartoonsparkle

Illustrative + Color claw marks tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Illustrative, Color
claw marksscratcheswoundsgoremonsterinjuryhorroraggressive

nose tattoo on Face by Ariesinkedme on TattMe — Face
nosepiercingstudhoopskinfacejewelry

Lettering + Script lettering tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Script, Black-work, Fine Line
letteringscriptwordtextcursivecalligraphyphrase

Black-work + Pop Culture ape tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Black-work, Pop Culture, Illustrative, Color
apebapecrown of thornspop culturereligiousstreetwearblackoutcharacteranimalgreen

Watercolor + Color script tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Watercolor, Color, Script
scriptsymbolswatercolor washabstract shapescolorfulpastel colorsvibrant

Fine Line + Minimalist abstract shape tattoo on Hip by Ariesinkedme on TattMe — Hip
Fine Line, Minimalist
abstract shapeline artminimalistorganic formdelicatesymbolic

Lettering + Script woman tattoo on Calf by Ariesinkedme on TattMe — Calf
Lettering, Script, Black-work, Illustrative
womancrownhandstextsilhouettescriptureempowerment

Lettering + Script serenity prayer tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Lettering, Script
serenity prayerscripttextnumbersblue inkwisdomcouragefaith

Fine Line + Minimalist cat tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Fine Line, Minimalist, Script, Lettering
catfishhookcrownscripttextminimalistanimaloutlinepet

Floral + Color flowers tattoo on Side (Torso) by Ariesinkedme on TattMe — Side (Torso)
Floral, Color, Black-work, Illustrative, Tribal
flowersvinesleavespatternsfloral designstropical elementsbotanical motifs

Gothic + Color cross tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Gothic, Color, Black-work, Illustrative
crossspiderspiderwebsymbolgothicornamentinsectcreaturedesignink

Lettering + Black-work character tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Black-work, Fine Line, Symbolic
characterkanjisymbolwritingwristbandred backgroundblack ink

Lettering + Dot-work letters tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Dot-work
letterstexttypographypixelsname

Pop Culture + Cartoon kaws tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Pop Culture, Cartoon, Color, Illustrative
kawsmurakami flowercartoon characterspop artroseskulltextgraphiccollectible toys

Black-work + Symbolic symbols tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Black-work, Symbolic, Line-work
symbolspatternsadinkra symbolsgeometric shapesheart shapeclover shapeornamentscultural symbolsblack ink

Fine Line + Minimalist lotus tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Fine Line, Minimalist
lotusflowerunalomedotssymbol

Lettering + Script script tattoo on Ribs by Ariesinkedme on TattMe — Ribs
Lettering, Script, Color, Watercolor
scriptletteringquoteheartnametextcolorwatercolor effect

Line-work + Black-work tardis tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Line-work, Black-work, Pop Culture, Sketch
tardispolice boxdoctor whosci-fitelevisionbuildinglinesfandom

Lettering + Script joy tattoo on Face by Ariesinkedme on TattMe — Face
Lettering, Script, Fine Line, Black-work
joywordscripttextlettersdelicateminimal

Black-work + Abstract brush stroke tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Black-work, Abstract
brush strokeabstract shapeblack inksymboltexture

Color + Illustrative rose tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Color, Illustrative
roseflowersleavesstarsbotanicalnature

Black-work + Illustrative motorcycle tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Black-work, Illustrative
motorcyclebikevehiclesilhouettedesignenginetransportation

Lettering + Fine Line crown tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Fine Line, Color
crowntextquoteladybuginsectsymbolic

Color + Illustrative cross tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Color, Illustrative, Symbolic, Sculptural, Gothic
crossredsymbolsharpjaggedabstract

Black & Grey + Lettering claw marks tattoo on Upper Arm by Ariesinkedme on TattMe — Upper Arm
Black & Grey, Lettering
claw marksscratchesbeastletteringtextwordaggressionpowertexturewounds

Lettering + Black-work text tattoo on Calf by Ariesinkedme on TattMe — Calf
Lettering, Black-work, Script
textletteringquotescriptgothic fontinscriptionphrasewordsmotivation

Lettering + Script kanji tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Lettering, Script, Black-work
kanjipeacestrengthlovesymbolscharacterstextblack ink

Lettering + Script fearless tattoo on Thigh by Ariesinkedme on TattMe — Thigh
Lettering, Script, Fine Line, Black & Grey
fearlesswordscripttexttypographyinspiration

Lettering + Script script tattoo on Wrist by Ariesinkedme on TattMe — Wrist
Lettering, Script, Color, Fine Line
scriptletteringwordcrownflamesunstarsdiamondstext

Lettering + Script kanji tattoo on Behind Ear by Ariesinkedme on TattMe — Behind Ear
Lettering, Script, Color
kanjicharactersymbolscriptearringchainsbeardhead wrapred inkfresh tattoo

Japanese + Minimalist katana tattoo on Calf by Ariesinkedme on TattMe — Calf
Japanese, Minimalist, Black-work, Illustrative
katanaswordensobrush strokecirclejapanesesymbolminimalistabstract

Color + Lettering video game tattoo on Forearm by Ariesinkedme on TattMe — Forearm
Color, Lettering, Pop Culture, Illustrative
video gameborderlandsvault symbolletteringpixel artsplattersymbol